PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10000155m
Common NameCARUB_v10000155mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 956aa    MW: 106732 Da    PI: 5.0711
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10000155mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.3e-183278148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEde l +av+ + g++Wk+Ia+++   Rt+ qc +rwqk+l
  Carubv10000155m 32 RGQWTAEEDEVLRKAVHSFKGKNWKKIAEYFK-DRTDVQCLHRWQKVL 78
                     89*****************************9.************986 PP

2Myb_DNA-binding64.71.7e-2084130148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEde +v+++k++G++ W+tIar+++ gR +kqc++rw+++l
  Carubv10000155m  84 KGPWTKEEDEMIVQLIKKYGPKKWSTIARYLP-GRIGKQCRERWHNHL 130
                      79******************************.*************97 PP

3Myb_DNA-binding431e-13136178145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE++ l++a++ +G++ W+   + ++ gR+++ +k++w+
  Carubv10000155m 136 KEAWTQEEELVLIRAHQIYGNR-WAELTKFLP-GRSDNGIKNHWH 178
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.8992778IPR017930Myb domain
SMARTSM007178.7E-153180IPR001005SANT/Myb domain
PfamPF002491.2E-153278IPR001005SANT/Myb domain
SuperFamilySSF466892.66E-153388IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-233489IPR009057Homeodomain-like
CDDcd001672.18E-133578No hitNo description
PROSITE profilePS5129433.17179134IPR017930Myb domain
SuperFamilySSF466892.7E-3181177IPR009057Homeodomain-like
SMARTSM007171.2E-1983132IPR001005SANT/Myb domain
PfamPF002493.5E-1884130IPR001005SANT/Myb domain
CDDcd001672.97E-1786130No hitNo description
Gene3DG3DSA:1.10.10.604.0E-2790134IPR009057Homeodomain-like
PROSITE profilePS5129418.094135185IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-19135185IPR009057Homeodomain-like
SMARTSM007171.5E-12135183IPR001005SANT/Myb domain
PfamPF002499.5E-12136178IPR001005SANT/Myb domain
CDDcd001671.00E-9138178No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 956 aa     Download sequence    Send to blast
MESESTTIST PQEGIPKSRH GRTSGPARRS TRGQWTAEED EVLRKAVHSF KGKNWKKIAE  60
YFKDRTDVQC LHRWQKVLNP ELVKGPWTKE EDEMIVQLIK KYGPKKWSTI ARYLPGRIGK  120
QCRERWHNHL NPAINKEAWT QEEELVLIRA HQIYGNRWAE LTKFLPGRSD NGIKNHWHSS  180
VKKKLDSYMS SGLLDQYQAI PLAPYERSST LESAFMQSNI DGNGCLSGQA EKEIDSRQSS  240
SMIGCSLSAG DFPNGPINME HHFYPCGNSQ ETEQAVYHPE QYFYPELEDI SVSISEVSYD  300
MEDCSQFPDH NVSTSPSQDY HFDFQELSEI SLEMRQNMSE VPMPYTQESK EPTLGATNST  360
SYIDVATYTS SANVLTPETE CCRVLFPDQE SEGQSVSRSL TQEPNEVDQS DSRDPSLCTS  420
ASDSQISEAT KSPMQSSSSR SIATAASGKE TLRPAPLIIS PDKYAKKPSR LICHPFEAEP  480
KCTTNGNGSF ICINDPSSST CVDGGTSNPG EEDQSYHVND SKKLVAVSDF ASLSEDRPHS  540
LPRHEENTTS EQDHEDMGAS SSLGFPSLDL PVFSCDLLQS KNDPLHDYSP LGIRKLLMST  600
MTCMSPLRLW ESPTGKKTLV GTKSILRKRT RDLLTPLSEK RSDKKLETDI AASLAKDFSR  660
LDVMFDESEN RESISGNITG VILGDRESGG EGEENWKPSS LFSHRMLEET MHIRKSFEKT  720
CIEANVREKD GSEANVENAE SISGVLSEHN TCKSVLTSPG QSVTKAEKAH VLTPRNQFQK  780
TFMATSNKEQ HSSSSLCLVI NSPSRARNAE GHLVDNETSN ENFSIFCGTP FRRGLESPSA  840
WKSPFYVNSL LPSPRFDTEI TIEDMGYIFS PGERSYESLG VMTQLNEHAS AFAAFTDAME  900
VSISPTNDNA EQKKELNKEN NDPLLAERRV LDFNDCESPI KATEEVSSYL LKGCR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C8e-69321856159MYB PROTO-ONCOGENE PROTEIN
1h88_C8e-69321856159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3719750.0AF371975.2 Arabidopsis thaliana putative c-myb-like transcription factor MYB3R-4 (MYB3R4) mRNA, complete cds.
GenBankAY5196500.0AY519650.1 Arabidopsis thaliana MYB transcription factor (At5g11510) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006287007.10.0hypothetical protein CARUB_v10000155mg
TrEMBLR0H5A00.0R0H5A0_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.6__1121__AT5G11510.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM132131828
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.10.0myb domain protein 3r-4